PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_10646
Common NameKK1_010955
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 329aa    MW: 37420.9 Da    PI: 7.5782
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_10646genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.71.3e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
    C.cajan_10646 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding42.71.3e-1367110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+  ++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
    C.cajan_10646  67 RGAFSQQEENSIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.0E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466892.73E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002492.2E-161461IPR001005SANT/Myb domain
CDDcd001676.26E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2565116IPR009057Homeodomain-like
SMARTSM007172.0E-1166114IPR001005SANT/Myb domain
PROSITE profilePS5129419.25166116IPR017930Myb domain
PfamPF002491.3E-1267111IPR001005SANT/Myb domain
CDDcd001676.50E-869109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENSIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPNTHQPLS EVGNDKDKAL TADNKSNQKG NNEVNRFGTY HENCITSSDM MGMGYFPFQH  180
LNYGPNMGLT TTNTPLCFMP SSTSSQIMSE LNSTMLHSVS NFLDSNTITW GLQQAESANN  240
NKDAHSHVVP LQSEQEDIKW SEYLNTPFFL GTTVQHQTTH SIYSDEVKPE TGFIADESST  300
SWQHIQHFQP SDIYTKDLQR FSMACGQTL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311860.0KT031186.1 Glycine max clone HN_CCL_14 MYB/HD-like transcription factor (Glyma03g38660.2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304574.11e-172transcription factor MYB86
SwissprotQ8LPH62e-89MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A151TXC30.0A0A151TXC3_CAJCA; Transcription factor MYB86
STRINGGLYMA03G38660.11e-171(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-116myb domain protein 61